ARID1B monoclonal antibody (M01), clone 2D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARID1B.
Immunogen
ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARID1B monoclonal antibody (M01), clone 2D2 Western Blot analysis of ARID1B expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARID1B is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ARID1B
Entrez GeneID
57492GeneBank Accession#
NM_017519Protein Accession#
NP_059989Gene Name
ARID1B
Gene Alias
6A3-5, BAF250b, BRIGHT, DAN15, ELD/OSA1, KIAA1235, p250R
Gene Description
AT rich interactive domain 1B (SWI1-like)
Gene Ontology
HyperlinkOther Designations
BRG1-binding protein ELD/OSA1|Eld (eyelid)/Osa protein|OTTHUMP00000040115
-
Interactomes
-
Diseases
-
Publication Reference
-
Establishment and characterization of VOA1066 cells: An undifferentiated endometrial carcinoma cell line.
Yemin Wang, Valerie Lan Tao, Chae Young Shin, Clara Salamanca, Shary Yuting Chen, Christine Chow, Martin Köbel, Susana Ben-Neriah, David Farnell, Christian Steidl, Jessica N Mcalpine, C Blake Gilks, David G Huntsman.
PLoS One 2020 Oct; 15(10):e0240412.
Application:IHC, Human, Mouse, VOA1066 cells-derived mouse-xenograft tumor.
-
The genomic landscape of schwannoma.
Agnihotri S, Jalali S, Wilson MR, Danesh A, Li M, Klironomos G, Krieger JR, Mansouri A, Khan O, Mamatjan Y, Landon-Brace N, Tung T, Dowar M, Li T, Bruce JP, Burrell KE, Tonge PD, Alamsahebpour A, Krischek B, Agarwalla PK, Bi WL, Dunn IF, Beroukhim R, Fehlings MG, Bril V, Pagnotta SM, Iavarone A, Pugh TJ, Aldape KD, Zadeh G.
Nature Genetics 2016 Oct; 48(11):1339.
Application:IHC, Human, Schwannoma.
-
Concurrent ARID1A and ARID1B inactivation in endometrial and ovarian dedifferentiated carcinomas.
Coatham M, Li X, Karnezis AN, Hoang LN, Tessier-Cloutier B, Meng B, Soslow RA, Blake Gilks C, Huntsman DG, Stewart CJ, Postovit LM, Köbel M, Lee CH.
Modern Pathology 2016 Aug; 29(12):1586.
Application:IHC, Human, Dedifferentiated carcinoma of the endometrium or the ovary.
-
Loss of ARID1A, ARID1B, and ARID2 Expression During Progression of Gastric Cancer.
Aso T, Uozaki H, Morita S, Kumagai A, Watanabe M.
Anticancer Research 2015 Dec; 35(12):6819.
Application:IHC, Human, Gastric tumor.
-
Frequent loss of the expression of multiple subunits of the SWI/SNF complex in large cell carcinoma and pleomorphic carcinoma of the lung.
Yoshimoto T, Matsubara D, Nakano T, Tamura T, Endo S, Sugiyama Y, Niki T.
Pathology International 2015 Nov; 65(11):595.
Application:IHC-P, Human, Lung cancer.
-
Establishment and characterization of VOA1066 cells: An undifferentiated endometrial carcinoma cell line.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com