Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

MDS032 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00055850-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MDS032 protein.
  • Immunogen:
  • MDS032 (NP_060937, 1 a.a. ~ 259 a.a) full-length human protein.
  • Sequence:
  • MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (88); Rat (88)
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • MDS032 MaxPab polyclonal antibody. Western Blot analysis of MDS032 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of USE1 expression in transfected 293T cell line (H00055850-T01) by USE1 MaxPab polyclonal antibody.

    Lane 1: MDS032 transfected lysate(28.49 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • USE1
  • Gene Alias:
  • MDS032,P31,SLT1
  • Gene Description:
  • unconventional SNARE in the ER 1 homolog (S. cerevisiae)
  • Other Designations:
  • Q-SNARE,SNARE-like tail-anchored protein 1 homolog,putative MAPK activating protein PM26,uncharacterized hematopoietic stem/progenitor cells protein MDS032
  • RSS
  • YouTube
  • Linkedin
  • Facebook