CLEC2D monoclonal antibody (M01), clone 4C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CLEC2D.
Immunogen
CLEC2D (AAH19883, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.68 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CLEC2D expression in transfected 293T cell line by CLEC2D monoclonal antibody (M01), clone 4C7.
Lane 1: CLEC2D transfected lysate(21.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLEC2D on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLEC2D is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CLEC2D
Entrez GeneID
29121GeneBank Accession#
BC019883Protein Accession#
AAH19883Gene Name
CLEC2D
Gene Alias
CLAX, LLT1, OCIL
Gene Description
C-type lectin domain family 2, member D
Omim ID
605659Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified, but the full-length nature of every transcript has not been defined. [provided by RefSeq
Other Designations
C-type lectin related f|C-type lectin superfamily 2, member D|lectin-like NK cell receptor|lectin-like transcript 1|osteoclast inhibitory lectin
-
Interactome
-
Disease
-
Publication Reference
-
Vaccinia Virus WR induces rapid surface expression of a host molecule detected by the antibody 4C7 that is distinct from CLEC2D.
Williams KJ, Eaton HE, Jones L, Rengan S, Burshtyn DN.
Microbiology and Immunology 2016 Nov; 60(11):754.
Application:Flow Cyt, IF, Human, 221 cells.
-
Expression of Lectin-Like Transcript 1, the Ligand for CD161, in Rheumatoid Arthritis.
Chalan P, Bijzet J, Huitema MG, Kroesen BJ, Brouwer E, Boots AM.
PLoS One 2015 Jul; 10(7):e0132436.
Application:IHC-P, Human, Rheumatoid synovial tissues.
-
Induction of LLT1 cell surface expression by pathogens and IFN-{gamma} contributes to modulate immune responses.
Germain C, Meier A, Jensen T, Knapnougel P, Poupon G, Lazzari A, Neisig A, Hakansson K, Dong T, Wagtmann N, Galsgaard ED, Spee P, Braud VM.
The Journal of Biological Chemistry 2011 Nov; 286(44):37964.
-
Characterization of Alternatively Spliced Transcript Variants of CLEC2D Gene.
Germain C, Bihl F, Zahn S, Poupon G, Dumaurier MJ, Rampanarivo HH, Padkjar SB, Spee P, Braud VM.
The Journal of Biological Chemistry 2010 Nov; 285(46):36207.
Application:Flow Cyt, Human, C1R, C1R-LLT1 cells.
-
Functional Consequences of Interactions between Human NKR-P1A and Its Ligand LLT1 Expressed on Activated Dendritic Cells and B Cells.
Rosen DB, Cao W, Avery DT, Tangye SG, Liu YJ, Houchins JP, Lanier LL.
Journal of Immunology 2008 May; 180(10):6508.
Application:Flow Cyt, Mouse, Ba/F3 cells.
-
Malignant Glioma Cells Counteract Antitumor Immune Responses through Expression of Lectin-Like Transcript-1.
Roth P, Mittelbronn M, Wick W, Meyermann R, Tatagiba M, Weller M.
Cancer Research 2007 Apr; 67(8):3540.
Application:IHC-P, WB-Ce, Human, Cells A172, D247MG, LN-18, LN-428, LN-319, LNT-229, LN-308, SV40-FHAS, T98G, U138-MG, U251MG, U373MG cells ; Tissues: Normal human brain gray and white matter, gliomas of different grades of malignan.
-
Vaccinia Virus WR induces rapid surface expression of a host molecule detected by the antibody 4C7 that is distinct from CLEC2D.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com