Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

HOM-TES-103 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00025900-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HOM-TES-103 protein.
  • Immunogen:
  • HOM-TES-103 (NP_542769.2, 1 a.a. ~ 200 a.a) full-length human protein.
  • Sequence:
  • MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (97); Rat (97)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IFFO1 expression in transfected 293T cell line (H00025900-T01) by IFFO1 MaxPab polyclonal antibody.

    Lane 1: HOM-TES-103 transfected lysate(22 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • IFFO1
  • Gene Alias:
  • DKFZp586I2223,FLJ20703,HOM-TES-103,IFFO,MGC117359
  • Gene Description:
  • intermediate filament family orphan 1
  • Gene Summary:
  • This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq
  • Other Designations:
  • HOM-TES-103 tumor antigen-like,intermediate filament family orphan,intermediate filament-like MGC:2625
  • RSS
  • YouTube
  • Linkedin
  • Facebook