MFN2 monoclonal antibody (M03J), clone 4H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant MFN2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
MFN2 (NP_055689, 661 a.a. ~ 757 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03A), clone 4H8.
Lane 1: MFN2 transfected lysate(86.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MFN2 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi ( Cat # H00009927-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody (M03), clone 4H8 (Cat # H00009927-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — MFN2
Entrez GeneID
9927GeneBank Accession#
NM_014874Protein Accession#
NP_055689Gene Name
MFN2
Gene Alias
CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF
Gene Description
mitofusin 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000002509|hyperplasia suppressor|mitochondrial assembly regulatory factor|mitofusin-2|transmembrane GTPase MFN2
-
Interactomes
-
Diseases
-
Publication Reference
-
Homozygous mutations in MFN2 cause multiple symmetric lipomatosis associated with neuropathy.
Sawyer SL, Cheuk-Him Ng A, Innes AM, Wagner JD, Dyment DA, Tetreault M; Care4Rare Canada Consortium, Majewski J, Boycott KM, Screaton RA, Nicholson G.
Human Molecular Genetics 2015 Sep; 24(18):5109.
Application:WB, WB-Tr, WB-Ti, Human, Mouse, Fibroblasts, Liver, Brain, Heart, Brown fat, Muscle, Pancreas.
-
Homozygous mutations in MFN2 cause multiple symmetric lipomatosis associated with neuropathy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com