Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

AKR1C3 MaxPab mouse polyclonal antibody (B02P) MaxPab

  • Catalog # : H00008644-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human AKR1C3 protein.
  • Immunogen:
  • AKR1C3 (NP_003730.4, 1 a.a. ~ 323 a.a) full-length human protein.
  • Sequence:
  • MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (73); Rat (71)
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • AKR1C3 MaxPab polyclonal antibody. Western Blot analysis of AKR1C3 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AKR1C3 expression in transfected 293T cell line (H00008644-T02) by AKR1C3 MaxPab polyclonal antibody.

    Lane 1: AKR1C3 transfected lysate(35.53 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8644
  • Gene Name:
  • AKR1C3
  • Gene Alias:
  • DD3,DDX,HA1753,HAKRB,HAKRe,HSD17B5,KIAA0119,hluPGFS
  • Gene Description:
  • aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018996,aldo-keto reductase family 1, member C3,chlordecone reductase,dihydrodiol dehydrogenase 3,dihydrodiol dehydrogenase X,hydroxysteroid (17-beta) dehydrogenase 5,prostaglandin F synthase,trans-1,2-dihydrobenzene-1,2-diol dehydrogenase,type
  • RSS
  • YouTube
  • Linkedin
  • Facebook