ZEB1 monoclonal antibody (M01), clone 4C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZEB1.
Immunogen
ZEB1 (NP_110378, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZEB1 is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence (Circulating Tumor Cell)
U-2 OS cells were stained with ZEB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to ZEB1 on U-2 OS cell. [antibody concentration 10 ug/ml]Immunofluorescence
Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ZEB1
Entrez GeneID
6935GeneBank Accession#
NM_030751Protein Accession#
NP_110378Gene Name
ZEB1
Gene Alias
AREB6, BZP, DELTA-EF1, MGC133261, NIL-2-A, NIL-2A, NIL2A, TCF8, ZEB, ZFHEP, ZFHX1A
Gene Description
zinc finger E-box binding homeobox 1
Gene Ontology
HyperlinkGene Summary
ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM
Other Designations
OTTHUMP00000019405|transcription factor 8 (represses interleukin 2 expression)|zinc finger homeodomain enhancer-binding protein
-
Interactomes
-
Diseases
-
Publication Reference
-
Variable effects of periprostatic adipose tissue on prostate cancer cells: Role of adipose tissue lipid composition and cancer cells related factors.
Mathilde Cancel, David Crottes, Dorine Bellanger, Frank Bruyère, Coralie Mousset, Michelle Pinault, Karine Mahéo, Gaëlle Fromont.
Prostate 2024 Mar; 84(4):358.
Application:IHC-P, Human, Prostate.
-
Eugenol modulates genomic methylation and inactivates breast cancer-associated fibroblasts through E2F1-dependent downregulation of DNMT1/DNMT3A.
Layla A Al-Kharashi, Tala Bakheet, Wejdan A AlHarbi, Nisreen Al-Moghrabi, Abdelilah Aboussekhra.
Molecular Carcinogenesis 2021 Nov; 60(11):784.
Application:WB-Ce, Human, MDA‐MB‐231 cells.
-
Specificities of small cell neuroendocrine prostate cancer: Adverse prognostic value of TTF1 expression.
Mathilde Cancel, Claire Castellier, Celine Debiais-Delpech, Thomas Charles, François Rozet, Nathalie Rioux-Leclercq, Romain Mathieu, Françoise Beltjens, Luc Cormier, Franck Bruyère, Gaëlle Fromont.
Urologic Oncology 2020 Jul; S1078-1439(20)30329-X.
Application:IHC, Human, NEPCa tumor.
-
Functional organotypic cultures of prostate tissues: a relevant preclinical model that preserves hypoxia sensitivity and calcium signaling.
Figiel S, Pasqualin C, Bery F, Maupoil V, Vandier C, Potier-Cartereau M, Domingo I, Guibon R, Bruyere F, Maheo K, Fromont G.
The American Journal of Pathology 2019 Jun; 189(6):1268.
Application:IHC-P, Human, Human prostate cancer.
-
Let-7b inhibits cancer-promoting effects of breast cancer-associated fibroblasts through IL-8 repression.
Al-Harbi B, Hendrayani SF, Silva G, Aboussekhra A.
Oncotarget 2018 Apr; 9(25):17825.
Application:WB, Human, MDA-MB-231 cells.
-
Obesity and p16INK4A Downregulation Activate Breast Adipocytes and Promote Their Protumorigenicity.
Al-Khalaf HH, Amir M, Al-Mohanna F, Tulbah A, Al-Sayed A, Aboussekhra A.
Molecular and Cellular Biology 2017 Sep; 37(17):e00101.
Application:WB-Ti, Human, MDA-MB-231 xenograft tumor.
-
p16INK4A induces senescence and inhibits EMT through microRNA‐141/microRNA‐146b‐5p‐dependent repression of AUF1.
Al-Khalaf HH, Aboussekhra A.
Molecular Carcinogenesis 2017 Mar; 56(3):985.
Application:WB-Tr, Human, MDA-MB-231 cells.
-
The Cytokine IL-6 Reactivates Breast Stromal Fibroblasts through Transcription Factor STAT3-dependent Up-regulation of the RNA Binding Protein AUF1.
Hendrayani SF, Al-Khalaf HH, Aboussekhra A.
The Journal of Biological Chemistry 2014 Nov; 289(45):30962.
Application:WB-Tr, Human, MDA-MB-231 cells.
-
Variable effects of periprostatic adipose tissue on prostate cancer cells: Role of adipose tissue lipid composition and cancer cells related factors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com