PSMB4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human PSMB4 protein.
Immunogen
PSMB4 (NP_002787.2, 1 a.a. ~ 264 a.a) full-length human protein.
Sequence
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PSMB4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB4 expression in human placenta.Western Blot (Cell lysate)
PSMB4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB4 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of PSMB4 expression in transfected 293T cell line (H00005692-T02) by PSMB4 MaxPab polyclonal antibody.
Lane 1: PSMB4 transfected lysate(29.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PSMB4
Entrez GeneID
5692GeneBank Accession#
NM_002796Protein Accession#
NP_002787.2Gene Name
PSMB4
Gene Alias
HN3, HsN3, PROS26
Gene Description
proteasome (prosome, macropain) subunit, beta type, 4
Omim ID
602177Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. [provided by RefSeq
Other Designations
macropain beta chain|multicatalytic endopeptidase complex beta chain|proteasome beta 4 subunit|proteasome beta chain|proteasome chain 3|proteasome subunit HsN3|proteasome subunit, beta type, 4
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com