HOXB9 monoclonal antibody (M05), clone 4C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant HOXB9.
Immunogen
HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M05), clone 4C11.
Lane 1: HOXB9 transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of HOXB9 transfected lysate using anti-HOXB9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXB9 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXB9 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — HOXB9
Entrez GeneID
3219GeneBank Accession#
NM_024017Protein Accession#
NP_076922.1Gene Name
HOXB9
Gene Alias
HOX-2.5, HOX2, HOX2E
Gene Description
homeobox B9
Omim ID
142964Gene Ontology
HyperlinkGene Summary
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq
Other Designations
homeo box 2E|homeo box B9
-
Interactome
-
Disease
-
Publication Reference
-
A miR-192-EGR1-HOXB9 regulatory network controls the angiogenic switch in cancer.
Wu SY, Rupaimoole R, Shen F, Pradeep S, Pecot CV, Ivan C, Nagaraja AS, Gharpure KM, Pham E, Hatakeyama H, McGuire MH, Haemmerle M, Vidal-Anaya V, Olsen C, Rodriguez-Aguayo C, Filant J, Ehsanipour EA, Herbrich SM, Maiti SN, Huang L, Kim JH, Zhang X, Han HD, Armaiz-Pena GN, Seviour EG, Tucker S, Zhang M, Yang D, Cooper LJ, Ali-Fehmi R, Bar-Eli M, Lee JS, Ram PT, Baggerly KA, Lopez-Berestein G, Hung MC, Sood AK.
Nature Communications 2016 Apr; 7:11169.
Application:ChIP, Human, HeyA8 cells.
-
A miR-192-EGR1-HOXB9 regulatory network controls the angiogenic switch in cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com