CDKN1A monoclonal antibody (M02), clone 2F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDKN1A.
Immunogen
CDKN1A (AAH00312.1, 65 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CDKN1A monoclonal antibody (M02), clone 2F1. Western Blot analysis of CDKN1A expression in human liver.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDKN1A is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CASP3 and CDKN1A. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-CDKN1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to CDKN1A on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CDKN1A
Entrez GeneID
1026GeneBank Accession#
NM_000389Protein Accession#
AAH00312.1Gene Name
CDKN1A
Gene Alias
CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Gene Description
cyclin-dependent kinase inhibitor 1A (p21, Cip1)
Omim ID
116899Gene Ontology
HyperlinkGene Summary
This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Two alternatively spliced variants, which encode an identical protein, have been reported. [provided by RefSeq
Other Designations
CDK-interaction protein 1|DNA synthesis inhibitor|OTTHUMP00000016298|cyclin-dependent kinase inhibitor 1A|melanoma differentiation associated protein 6|wild-type p53-activated fragment 1
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Increase of Intracellular Cyclic Amp by PDE4 Inhibitors Affects HepG2 Cell Cycle Progression and Survival.
Massimi M, Cardarelli S, Galli F, Giardi MF, Ragusa F, Panera N, Cinque B, Cifone MG, Biagioni S, Giorgi M.
Journal of Cellular Biochemistry 2017 Jun; 118(6):1401.
Application:WB, Human, HepG2 cells.
-
Phospho-ΔNp63α is a key regulator of the cisplatin-induced microRNAome in cancer cells.
Huang Y, Chuang A, Hao H, Talbot C, Sen T, Trink B, Sidransky D, Ratovitski E.
Cell Death and Differentiation 2011 Jul; 18(7):1220.
Application:WB-Tr, Human, JHU-029 cells.
-
Increase of Intracellular Cyclic Amp by PDE4 Inhibitors Affects HepG2 Cell Cycle Progression and Survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com