BDNF (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BDNF full-length ORF ( NP_733927.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
55.3
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BDNF
Entrez GeneID
627GeneBank Accession#
NM_170731.3Protein Accession#
NP_733927.1Gene Name
BDNF
Gene Alias
MGC34632
Gene Description
brain-derived neurotrophic factor
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq
Other Designations
neurotrophin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Intrathecal Delivery of BDNF into the Lumbar Cistern Re-Engages Locomotor Stepping after Spinal Cord Injury.
Francesca Marchionne, Alexander J Krupka, George M Smith, Michel A Lemay.
IEEE Transactions on Neural Systems and Rehabilitation Engineering 2020 Nov; 28(11):2459.
Application:Func, Cat, Cat lumbar cistern, Cat spinal cord.
-
Convection enhanced drug delivery of BDNF through a microcannula in a rodent model to strengthen connectivity of a peripheral motor nerve bridge model to bypass spinal cord injury.
Martin Bauknight W, Chakrabarty S, Hwang BY, Malone HR, Joshi S, Bruce JN, Sander Connolly E, Winfree CJ, Cunningham MG, Martin JH, Haque R.
Journal of Clinical Neuroscience 2012 Apr; 19(4):563.
Application:ELISA, IHC, WB, Rat, Spinal cord.
-
Intrathecal Delivery of BDNF into the Lumbar Cistern Re-Engages Locomotor Stepping after Spinal Cord Injury.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com