Product Browser

Last updated: 2015/8/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF1 (Human) Recombinant ProteinBioActive

  • Catalog # : P4385
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF1 (P05230) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of mouse BALB/c 3T3 cells. The expected ED50 for this effect is 0.8-1.2 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4385
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from 10 mM Na2PO4, 75 mM NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2246
  • Gene Name:
  • FGF1
  • Gene Alias:
  • AFGF,ECGF,ECGF-beta,ECGFA,ECGFB,FGF-alpha,FGFA,GLIO703,HBGF1
  • Gene Description:
  • fibroblast growth factor 1 (acidic)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000066028,OTTHUMP00000066030,OTTHUMP00000066031,OTTHUMP00000174675,endothelial cell growth factor, alpha,endothelial cell growth factor, beta,heparin-binding growth factor 1
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook