Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

LRG1 polyclonal antibody (A01)

  • Catalog # : H00116844-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant LRG1.
  • Immunogen:
  • LRG1 (AAH34389, 37 a.a. ~ 347 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00116844-A01
    Western Blot detection against Immunogen (60.32 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LRG1
  • Gene Alias:
  • HMFT1766,LRG
  • Gene Description:
  • leucine-rich alpha-2-glycoprotein 1
  • Gene Summary:
  • The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).[supplied by OMIM
  • Other Designations:
  • 1300008B03Rik,2310031E04Rik,leucine rich alpha 2 glycoprotein
  • RSS
  • YouTube
  • Linkedin
  • Facebook