NANOG monoclonal antibody (M01), clone 2C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant NANOG.
Immunogen
NANOG (NP_079141, 98 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (56); Rat (59)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NANOG monoclonal antibody (M01), clone 2C11 Western Blot analysis of NANOG expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NANOG is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NANOG
-
Interactomes
-
Publication Reference
-
Nanog1 in NTERA-2 and Recombinant NanogP8 from Somatic Cancer Cells Adopt Multiple Protein Conformations and Migrate at Multiple M.W Species.
Liu B, Badeaux MD, Choy G, Chandra D, Shen I, Jeter CR, Rycaj K, Lee CF, Person MD, Liu C, Chen Y, Shen J, Jung SY, Qin J, Tang DG.
PLoS One 2014 Mar; 9(3):e90615.
Application:WB-Ce, WB-Tr, Human, NTERA-2 cells.
-
Transcriptional properties of human NANOG1 and NANOG2 in acute leukemic cells.
Eberle I, Pless B, Braun M, Dingermann T, Marschalek R.
Nucleic Acids Research 2010 Sep; 38(16):5384.
Application:WB-Ce, WB-Tr, Human, HEK 293T cells.
-
Nanog1 in NTERA-2 and Recombinant NanogP8 from Somatic Cancer Cells Adopt Multiple Protein Conformations and Migrate at Multiple M.W Species.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com