SLC44A2 monoclonal antibody (M01), clone 3D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC44A2.
Immunogen
SLC44A2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC44A2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — SLC44A2
-
Interactomes
-
Publication Reference
-
Identification and functional analysis of choline transporter in tongue cancer: A novel molecular target for tongue cancer therapy.
Nishiyama R, Nagashima F, Iwao B, Kawai Y, Inoue K, Midori A, Yamanaka T, Uchino H, Inazu M.
Journal of Pharmacological Sciences 2016 Jun; 131(2):101.
Application:IF, WB-Ce, Human, HSC-3 cells.
-
Functional expression of choline transporter like-protein 1 (CTL1) and CTL2 in human brain microvascular endothelial cells.
Iwao B, Yara M, Hara N, Kawai Y, Yamanaka T, Nishihara H, Inoue T, Inazu M.
Neurochemistry International 2016 Feb; 93:40.
Application:IF, IHC, WB-Ce, Human, hBMECs cells, brain.
-
Functional analysis of [methyl-3H]choline uptake in glioblastoma cells: influence of anti-cancer and central nervous system drugs.
Taguchi C, Inazu M, Saiki I, Yara M, Hara N, Yamanaka T, Uchino H.
Biochemical Pharmacology 2014 Apr; 88(3):303.
Application:WB-Ce, Human, A-172, U-251MG cells.
-
Anti-human neutrophil antigen-3a induced transfusion-related acute lung injury in mice by direct disturbance of lung endothelial cells.
Bayat B, Tjahjono Y, Sydykov A, Werth S, Hippenstiel S, Weissmann N, Sachs UJ, Santoso S.
Arteriosclerosis, Thrombosis, and Vascular Biology 2013 Nov; 33(11):2538.
-
Molecular and functional characterization of choline transporter in rat renal tubule epithelial NRK-52E cells.
Yabuki M, Inazu M, Yamada T, Tajima H, Matsumiya T.
Archives of Biochemistry and Biophysics 2009 May; 485(1):88.
Application:IF, WB-Ce, Human, NRK-52E cells.
-
Identification and functional analysis of choline transporter in tongue cancer: A novel molecular target for tongue cancer therapy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com