AOF2 monoclonal antibody (M04), clone 2E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant AOF2.
Immunogen
AOF2 (NP_055828, 753 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AOF2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AOF2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to AOF2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — AOF2
Entrez GeneID
23028GeneBank Accession#
NM_015013Protein Accession#
NP_055828Gene Name
AOF2
Gene Alias
BHC110, KDM1, KIAA0601, LSD1
Gene Description
amine oxidase (flavin containing) domain 2
Omim ID
609132Gene Ontology
HyperlinkGene Summary
This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
BRAF35-HDAC complex protein BHC110|FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit|lysine (K)-specific demethylase 1|lysine-specific histone demethylase 1
-
Interactomes
-
Publication Reference
-
Characterization of histone lysine-specific demethylase in relation to thyroid hormone-regulated anuran metamorphosis.
Chen W, Obara M, Ishida Y, Suzuki K, Yoshizato K.
Development, Growth & Differentiation 2007 May; 49(4):325.
Application:IHC-P, Clawed frog, Tadpoles.
-
Characterization of histone lysine-specific demethylase in relation to thyroid hormone-regulated anuran metamorphosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com