AGR2 monoclonal antibody (M03), clone 1C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant AGR2.
Immunogen
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AGR2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of AGR2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M03), clone 1C3.
Lane 1: AGR2 transfected lysate(20 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AGR2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — AGR2
Entrez GeneID
10551GeneBank Accession#
BC015503Protein Accession#
AAH15503.1Gene Name
AGR2
Gene Alias
AG2, GOB-4, HAG-2, XAG-2
Gene Description
anterior gradient homolog 2 (Xenopus laevis)
Omim ID
606358Gene Ontology
HyperlinkOther Designations
anterior gradient 2 homolog|secreted cement gland homolog
-
Interactome
-
Disease
-
Publication Reference
-
AGR2 protein expression in colorectal tumour epithelialcompartment.
Eric Chevet, F Bassal, Stéphanie Beq, Benjamin Bonhomme, Emeric Boisteau, Julien Calloch, Dominique Cazals-Hatem, Frederic Delom, Delphine Fessart, Serge Evrard, Roman Hrstka, Ted Hupp, Astrid Lièvre, Edouard Louis, Jeremie Mariau, Marie-Alice Meuwis, Eric Ogier-Denis, Valerie Paradis, Simon Pernot, R Pineau, Xavier Treton, Valerie Velasco, Sophie Vieujean.
Gut 2022 Dec; [Epub].
Application:IHC, Human, Human colon.
-
Characterization of the AGR2 Interactome Uncovers New Players of Protein Disulfide Isomerase Network in Cancer Cells.
Pavla Bouchalova, Lucia Sommerova, David Potesil, Andrea Martisova, Petr Lapcik, Veronika Koci, Alex Scherl, Petr Vonka, Joan Planas-Iglesias, Eric Chevet, Pavel Bouchal, Roman Hrstka.
Molecular & Cellular proteomics: MCP 2022 Feb; 21(2):100188.
Application:IF, IP, PLA-Ce, WB-Ce, Human, A549, H1299, T47D cells.
-
Anterior gradient protein 2 is a marker of tumor aggressiveness in breast cancer and favors chemotherapy-induced senescence escape.
Amine Maarouf, Alice Boissard, Cécile Henry, Géraldine Leman, Olivier Coqueret, Catherine Guette, Eric Lelièvre.
International Journal of Oncology 2022 Jan; 60(1):5.
Application:WB-Ce, Human, 293, LS174T, MCF-7 cells.
-
AGR2-AGR3 hetero-oligomeric complexes: Identification and characterization.
Hana Černocká, Petr Vonka, Veronika Kasalová, Lucia Sommerova, Veronika Vandova, Roman Hrstka, Veronika Ostatna.
Bioelectrochemistry 2021 Aug; 140:107808.
Application:IP, Human, T-47D cells.
-
Extracellular AGR2 triggers lung tumour cell proliferation through repression of p21 CIP1.
Delphine Fessart, Claire de Barbeyrac, Ines Boutin, Thomas Grenier, Elodie Richard, Hughes Begueret, David Bernard, Eric Chevet, Jacques Robert, Frederic Delom.
Biochimica et Biophysica Acta. Molecular Cell Research 2021 Mar; 1868(3):118920.
Application:IF, IHC-P, WB-Ce, WB-Tr, Human, A-549 cells, Human lung cancer, H23 cells, H460 cells, H1838 cells, Human normal bronchial epithelial cells.
-
Suppression of AGR2 in a TGF-β-induced Smad regulatory pathway mediates epithelial-mesenchymal transition.
Sommerova L, Ondrouskova E, Vojtesek B, Hrstka R.
BMC Cancer 2017 Aug; 17(1):546.
Application:IF, WB-Ce, Human, A549, BT-474, NCI-H1299, MCF-7, Panc1 cells.
-
Targeted proteomics driven verification of biomarker candidates associated with breast cancer aggressiveness.
Procházková I, Lenčo J, Fučíková A, Dresler J, Čápková L, Hrstka R, Nenutil R, Bouchal P.
Biochimica et Biophysica Acta 2017 Feb; 1865(5):488.
Application:IHC-P, Human, Human breast cancer.
-
An efficient method for native protein purification in the selected range from prostate cancer tissue digests.
Ahmad R, Nicora CD, Shukla AK, Smith RD, Qian WJ, Liu AY.
Chinese Clinical Oncology 2016 Dec; 5(6):78.
Application:WB-Ti, Human, Human prostate cancer.
-
EGFR Signaling Requires a Specific Endoplasmic Reticulum Thioredoxin for the Post-Translational Control of Receptor Presentation to the Cell Surface.
Dong A, Wodziak D, Lowe AW.
The Journal of Biological Chemistry 2015 Mar; 290(13):8016.
Application:IP-WB, WB-Ce, Human, NCI-H460, A431, MCF-10A cells.
-
Loss of Anterior Gradient-2 expression is an independent prognostic factor in colorectal carcinomas.
Riener MO, Thiesler T, Hellerbrand C, Amann T, Cathomas G, Fritzsche FR, Dahl E, Bahra M, Weichert W, Terracciano L, Kristiansen G.
European Journal of Cancer 2014 Jul; 50(10):1722.
Application:IHC-P, WB-Tr, Human, Caco-2 cells, Colorectal carcinoma.
-
Development of a fluorescent monoclonal antibody-based assay to measure the allosteric effects of synthetic peptides on self-oligomerization of AGR2 protein.
Gray TA, Murray E, Nowicki MW, Remnant L, Scherl A, Muller P, Vojtesek B, Hupp TR.
Protein Science 2013 Sep; 22(9):1266.
Application:WB-Re, Recombinant protein.
-
Development of an ELISA to detect the secreted prostate cancer biomarker AGR2 in voided urine.
Wayner EA, Quek SI, Ahmad R, Ho ME, Loprieno MA, Zhou Y, Ellis WJ, True LD, Liu AY.
Prostate 2012 Jun; 72(9):1023.
Application:ELISA, Human, 08-013NP, C4-2 cells.
-
Anterior gradient protein 2 (AGR2) is an independent prognostic factor in ovarian high-grade serous carcinoma.
Darb-Esfahani S, Fritzsche F, Kristiansen G, Weichert W, Sehouli J, Braicu I, Dietel M, Denkert C.
Virchows Archiv 2012 Aug; 461(2):109.
Application:IHC-P, Human, Human ovarian high-grade serous carcinoma.
-
Differential expression of the anterior gradient protein-2 is a conserved feature during morphogenesis and carcinogenesis of the biliary tree.
Lepreux S, Bioulac-Sage P, Chevet E.
Liver International 2011 Mar; 31(3):322.
Application:IHC, Human, Liver.
-
A Divergent Substrate-Binding Loop within the Pro-oncogenic Protein Anterior Gradient-2 Forms a Docking Site for Reptin.
Maslon MM, Hrstka R, Vojtesek B, Hupp TR.
Journal of Molecular Biology 2010 Oct; 404(3):418.
Application:WB, Human, MCF-7, NCI-H1299 cells.
-
2,3,7,8-Tetrachlorodibenzo-p-Dioxin Counteracts the p53 Response to a Genotoxicant by Upregulating Expression of the Metastasis Marker AGR2 in the Hepatocarcinoma Cell Line HepG2.
Ambolet-Camoit A, Bui LC, Pierre S, Chevallier A, Marchand A, Coumoul X, Garlatti M, Andreau K, Barouki R, Aggerbeck M.
Toxicological Sciences 2010 Jun; 115(2):501.
Application:WB, Human, HepG2 cells.
-
Identification of Candidate Biomarkers of Therapeutic Response to Docetaxel by Proteomic Profiling.
Zhao L, Lee BY, Brown DA, Molloy MP, Marx GM, Pavlakis N, Boyer MJ, Stockler MR, Kaplan W, Breit SN, Sutherland RL, Henshall SM, Horvath LG.
Cancer Research 2009 Oct; 69(19):7696.
Application:WB-Ce, WB-Tr, Human, PC-3 cells.
-
AGR2 protein expression in colorectal tumour epithelialcompartment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com