Product Browser

Last updated: 2015/8/30
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANAPC10 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00010393-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ANAPC10 protein.
  • Immunogen:
  • ANAPC10 (AAH05217.1, 1 a.a. ~ 185 a.a) full-length human protein.
  • Sequence:
  • MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ANAPC10 expression in transfected 293T cell line (H00010393-T02) by ANAPC10 MaxPab polyclonal antibody.

    Lane 1: ANAPC10 transfected lysate(20.35 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ANAPC10
  • Gene Alias:
  • APC10,DKFZp564L0562,DOC1
  • Gene Description:
  • anaphase promoting complex subunit 10
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook