Product Browser

Last updated: 2014/4/14

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

AKT3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010000-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AKT3 partial ORF ( AAD29089, 100 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010000-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • AKT3
  • Gene Alias:
  • DKFZp434N0250,PKB-GAMMA,PKBG,PRKBG,RAC-PK-gamma,RAC-gamma,STK-2
  • Gene Description:
  • v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
  • Gene Summary:
  • The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000037911,OTTHUMP00000037912,RAC-gamma serine/threonine protein kinase,protein kinase B gamma,serine threonine protein kinase, Akt-3,v-akt murine thymoma viral oncogene homolog 3
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook