Product Browser

Last updated: 2015/4/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MET polyclonal antibody (A01)

  • Catalog # : H00004233-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MET.
  • Immunogen:
  • MET (NM_000245, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4233
  • Gene Name:
  • MET
  • Gene Alias:
  • AUTS9,HGFR,RCCP2,c-Met
  • Gene Description:
  • met proto-oncogene (hepatocyte growth factor receptor)
  • Gene Summary:
  • The proto-oncogene MET product is the hepatocyte growth factor receptor and encodes tyrosine-kinase activity. The primary single chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor. Various mutations in the MET gene are associated with papillary renal carcinoma. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • HGF receptor,OTTHUMP00000069168,SF receptor,met proto-oncogene,met proto-oncogene tyrosine kinase,oncogene MET,scatter factor receptor
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook