SMAD1 monoclonal antibody (M06), clone 1B8

Catalog # H00004086-M06

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in NIH/3T3 ( Cat # L018V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in Raw 264.7 ( Cat # L024V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SMAD1 monoclonal antibody (M06), clone 1B8 Western Blot analysis of SMAD1 expression in HeLa ( Cat # L013V1 ).

QC Test

Western Blot detection against Immunogen (76.89 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a full length recombinant SMAD1.

    Immunogen

    SMAD1 (AAH01878.1, 1 a.a. ~ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (99)

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (76.89 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Cell lysate)

    SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Cell lysate)

    SMAD1 monoclonal antibody (M06), clone 1B8 Western Blot analysis of SMAD1 expression in HeLa ( Cat # L013V1 ).

    Western Blot (Recombinant protein)

    ELISA

  • Gene Info — SMAD1

    Entrez GeneID

    4086

    GeneBank Accession#

    BC001878

    Protein Accession#

    AAH01878.1

    Gene Name

    SMAD1

    Gene Alias

    BSP1, JV4-1, JV41, MADH1, MADR1

    Gene Description

    SMAD family member 1

    Omim ID

    601595

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq

    Other Designations

    MAD, mothers against decapentaplegic homolog 1|Mad-related protein 1|SMAD, mothers against DPP homolog 1|Sma- and Mad-related protein 1|TGF-beta signaling protein 1|mothers against DPP homolog 1|transforming growth factor-beta signaling protein 1

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All