Product Browser

Last updated: 2015/5/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KRAS (Human) Recombinant Protein (Q01)

  • Catalog # : H00003845-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KRAS partial ORF ( NP_004976, 16 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003845-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3845
  • Gene Name:
  • KRAS
  • Gene Alias:
  • C-K-RAS,K-RAS2A,K-RAS2B,K-RAS4A,K-RAS4B,KI-RAS,KRAS1,KRAS2,NS3,RASK2
  • Gene Description:
  • v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
  • Gene Summary:
  • This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq
  • Other Designations:
  • K-ras p21 protein,Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog,PR310 c-K-ras oncogene,c-K-ras2 protein,c-Kirsten-ras protein,cellular c-Ki-ras2 proto-oncogene,oncogene KRAS2,transforming protein p21,v-Ki-ras2 Kirsten rat sarcoma 2 viral oncoge
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook