Product Browser

Last updated: 2014/4/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

IFNA2 (Human) Recombinant Protein (P01)

  • Catalog # : H00003440-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNA2 full-length ORF ( NP_000596.2, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003440-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3440
  • Gene Name:
  • IFNA2
  • Gene Alias:
  • IFNA,INFA2,MGC125764,MGC125765
  • Gene Description:
  • interferon, alpha 2
  • Other Designations:
  • OTTHUMP00000021143,alpha-2a interferon,interferon alpha 2b,interferon alpha A
  • RSS
  • YouTube
  • Linkedin
  • Facebook