Product Browser

Last updated: 2014/4/14
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

AKR1C1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00001645-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human AKR1C1 protein.
  • Immunogen:
  • AKR1C1 (NP_001344.2, 1 a.a. ~ 323 a.a) full-length human protein.
  • Sequence:
  • MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • AKR1C1 MaxPab rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AKR1C1 expression in transfected 293T cell line (H00001645-T02) by AKR1C1 MaxPab polyclonal antibody.

    Lane 1: AKR1C1 transfected lysate(36.80 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 1645
  • Gene Name:
  • AKR1C1
  • Gene Alias:
  • 2-ALPHA-HSD,20-ALPHA-HSD,C9,DD1,DDH,DDH1,H-37,HAKRC,MBAB,MGC8954
  • Gene Description:
  • aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq
  • Other Designations:
  • 20 alpha-hydroxysteroid dehydrogenase,OTTHUMP00000018992,aldo-keto reductase C,aldo-keto reductase family 1, member C1,chlordecone reductase homolog,dihydrodiol dehydrogenase 1,dihydrodiol dehydrogenase isoform DD1,hepatic dihydrodiol dehydrogenase,trans-
  • RSS
  • YouTube
  • Linkedin
  • Facebook