Product Browser

Last updated: 2015/3/1
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MPPED2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00000744-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MPPED2 protein.
  • Immunogen:
  • MPPED2 (NP_001575.1, 1 a.a. ~ 294 a.a) full-length human protein.
  • Sequence:
  • MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • MPPED2 MaxPab polyclonal antibody. Western Blot analysis of MPPED2 expression in rat brain.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MPPED2 expression in transfected 293T cell line (H00000744-T01) by MPPED2 MaxPab polyclonal antibody.

    Lane 1: MPPED2 transfected lysate(32.34 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 744
  • Gene Name:
  • MPPED2
  • Gene Alias:
  • 239FB,C11orf8,D11S302E,FAM1B,Hs.46638,dJ1024C24.1,dJ873F21.1
  • Gene Description:
  • metallophosphoesterase domain containing 2
  • Gene Summary:
  • This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • dJ1024C24.1 (C11ORF8 protein),dJ873F21.1 (brain protein 239)
  • RSS
  • YouTube
  • Linkedin
  • Facebook