AK3L1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AK3L1 protein.
Immunogen
AK3L1 (NP_001002921, 1 a.a. ~ 223 a.a) full-length human protein.
Sequence
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AK3L1 MaxPab polyclonal antibody. Western Blot analysis of AK3L1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of AK3L1 expression in transfected 293T cell line (H00000205-T02) by AK3L1 MaxPab polyclonal antibody.
Lane 1: AK3L1 transfected lysate(24.53 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to AK3L1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — AK3L1
Entrez GeneID
205GeneBank Accession#
NM_001002921Protein Accession#
NP_001002921Gene Name
AK3L1
Gene Alias
AK3, AK4, MGC166959
Gene Description
adenylate kinase 3-like 1
Omim ID
103030Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq
Other Designations
ATP-AMP transphosphorylase|GTP:AMP phosphotransferase|OTTHUMP00000010594|mitochondrial adenylate kinase-3|nucleoside-triphosphate-adenylate kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com