Product Browser

Last updated: 2014/4/21
  • Related Product Showcase
  • By Research Area

  • By Hot Target

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

PARP4 polyclonal antibody (A01)

  • Catalog # : H00000143-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PARP4.
  • Immunogen:
  • PARP4 (NP_006428, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KENGGKFSFSLNPQCTHIILDNADVLSQYQLNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCPDSATEEEDTVELTEFGMQNV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000143-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 143
  • Gene Name:
  • PARP4
  • Gene Alias:
  • ADPRTL1,PARPL,PH5P,VAULT3,VPARP,VWA5C,p193
  • Gene Description:
  • poly (ADP-ribose) polymerase family, member 4
  • Gene Summary:
  • This gene encodes poly(ADP-ribosyl)transferase-like 1 protein, which is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. Since this protein is not capable of binding DNA directly, its transferase activity may be activated by other factors such as protein-protein interaction mediated by the extensive carboxyl terminus. [provided by RefSeq
  • Other Designations:
  • ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 1,H5 proline-rich,I-alpha-I-related,OTTHUMP00000018130,OTTHUMP00000042288,PARP-related,poly(ADP-ribose) synthetase,poly(ADP-ribosyl)transferase-like 1,vault protein, 193-kDa,von Willebrand f
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook