PSMC4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with PSMC4 polyclonal antibody (Cat # PAB28661) at 1:100-1:500 dilution.
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver Lane 6: Human tonsil tissue with PSMC4 polyclonal antibody (Cat # PAB28661) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human gallbladder with PSMC4 polyclonal antibody (Cat # PAB28661) shows nuclear positivity in glandular cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U373 MG with PSMC4 polyclonal antibody (Cat # PAB28661) at 1-4 ug/mL shows positivity in nucleus.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PSMC4.
Immunogen
Recombinant protein corresponding to amino acids of human PSMC4.
Sequence
LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with PSMC4 polyclonal antibody (Cat # PAB28661) at 1:100-1:500 dilution.Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver Lane 6: Human tonsil tissue with PSMC4 polyclonal antibody (Cat # PAB28661) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human gallbladder with PSMC4 polyclonal antibody (Cat # PAB28661) shows nuclear positivity in glandular cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U373 MG with PSMC4 polyclonal antibody (Cat # PAB28661) at 1-4 ug/mL shows positivity in nucleus. -
Gene Info — PSMC4
Entrez GeneID
5704Gene Name
PSMC4
Gene Alias
MGC13687, MGC23214, MGC8570, MIP224, S6, TBP7
Gene Description
proteasome (prosome, macropain) 26S subunit, ATPase, 4
Omim ID
602707Gene Ontology
HyperlinkGene Summary
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with an orphan member of the nuclear hormone receptor superfamily highly expressed in liver, and with gankyrin, a liver oncoprotein. Two transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
MB67 interacting protein|Tat-binding protein 7|protease 26S subunit 6|proteasome 26S ATPase subunit 4
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com