AQP4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant AQP4.
Immunogen
Recombinant protein corresponding to amino acids of human AQP4.
Sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with AQP4 polyclonal antibody (Cat # PAB20767).
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with AQP4 polyclonal antibody (Cat # PAB20767).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with AQP4 polyclonal antibody (Cat # PAB20767) shows strong cytoplasmic and membranous positivity in glandular cells. -
Gene Info — AQP4
Entrez GeneID
361Protein Accession#
P55087Gene Name
AQP4
Gene Alias
HMIWC2, MGC22454, MIWC
Gene Description
aquaporin 4
Omim ID
600308Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
aquaporin type4|aquaporin-4|mercurial-insensitive water channel
-
Interactome
-
Disease
-
Publication Reference
-
AQP4 labels a subpopulation of white matter-dependent glial radial cells affected by pediatric hydrocephalus, and its expression increased in glial microvesicles released to the cerebrospinal fluid in obstructive hydrocephalus.
Leandro Castañeyra-Ruiz, Ibrahim González-Marrero, Luis G. Hernández-Abad, Emilia M. Carmona-Calero, Marta R. Pardo, Rebeca Baz-Davila, Seunghyun Lee, Michael Muhonen, Ricardo Borges & Agustín Castañeyra-Perdomo.
Acta Neuropathologica Communications 2022 Mar; 10(1):41.
Application:Flow cyt, IF, Human, Human brain.
-
Preterm intraventricular hemorrhage in vitro: modeling the cytopathology of the ventricular zone.
Leandro Castaneyra-Ruiz, James P McAllister 2nd, Diego M Morales, Steven L Brody, Albert M Isaacs, David D Limbrick Jr.
Fluids and Barriers of the CNS 2020 Jul; 17(1):46.
Application:IHC, Mouse, Ventricular zone.
-
Organ Culture and Grafting of Choroid Plexus Into the Ventricular CSF of Normal and Hydrocephalic HTx Rats.
Conrad E Johanson, Karin Vío, Monserrat Guerra, Paula Salazar, María Clara Jara, Sara Rodríguez, Eduardo Ortega, Leandro Castañeyra-Ruiz, J Patrick McAllister, Esteban M Rodríguez.
Journal of Neuropathology and Eexperimental Neurology 2020 Jun; 79(6):626.
Application:IHC, Rat, Choroid plexus.
-
Neurospheres from neural stem/neural progenitor cells (NSPCs) of non-hydrocephalic HTx rats produce neurons, astrocytes and multiciliated ependyma: the cerebrospinal fluid of normal and hydrocephalic rats supports such a differentiation.
Henzi R, Guerra M, Vío K, González C, Herrera C, McAllister P, Johanson C, Rodríguez EM.
Cell and Tissue Research 2018 Aug; 373(2):421.
Application:IF, Rat, Neurospheres.
-
Paraneoplastic Neuromyelitis Optica Spectrum Disorder: A single center cohort description with two cases of histological validation.
Beauchemin P, Iorio R, Traboulsee AL, Field T, Tinker AV, Carruthers RL.
Multiple Sclerosis and Related Disorders 2018 Feb; 20:37.
Application:IF, IHC-P, Human, Paraneoplastic neuromyelitis optica spectrum disorder.
-
Blood-brain barrier and foetal-onset hydrocephalus, with a view on potential novel treatments beyond managing CSF flow.
Guerra M, Blázquez JL, Rodríguez EM.
Fluids and Barriers of the CNS 2017 Jul; 14(1):19.
Application:IF, Human, Human cerebral cortex.
-
Ventricular Zone Disruption in Human Neonates With Intraventricular Hemorrhage.
McAllister JP, Guerra MM, Ruiz LC, Jimenez AJ, Dominguez-Pinos D, Sival D, den Dunnen W, Morales DM, Schmidt RE, Rodriguez EM, Limbrick DD.
Journal of Neuropathology and Eexperimental Neurology 2017 May; 76(5):358.
Application:IF, IHC-P, Human, Brain specimens from preterm infants diagnosed with Intraventricular Hemorrhage.
-
Neuromyelitis optica spectrum disorder as a paraneoplastic manifestation of lung adenocarcinoma expressing aquaporin-4.
Iorio R, Rindi G, Erra C, Damato V, Ferilli M, Sabatelli M.
Multiple Sclerosis 2015 May; 21(6):791.
Application:IF, IHC-P, Human, Lung adenocarcinoma.
-
AQP4 labels a subpopulation of white matter-dependent glial radial cells affected by pediatric hydrocephalus, and its expression increased in glial microvesicles released to the cerebrospinal fluid in obstructive hydrocephalus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com