LILRB2 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
SDS-PAGE analysis of LILRB2 (Human) Recombinant Protein.
-
Specification
Product Description
Human LILRB2 (Q8N423, 24 a.a. - 461 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Sequence
GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGV
Host
Human
Theoretical MW (kDa)
48.3
Form
Liquid
Preparation Method
Mammalian cell (HEK 293) expression system
Purity
> 95% as analyzed by SDS-PAGE.
Endotoxin Level
< 1 EU/ug of protein by the LAL method.
Quality Control Testing
SDS-PAGE Stained with Coomassie Blue.
SDS-PAGE analysis of LILRB2 (Human) Recombinant Protein.
Recommend Usage
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.4 ( 20% glycerol)
Storage Instruction
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
SDS-PAGE
-
Gene Info — LILRB2
Entrez GeneID
10288Protein Accession#
Q8N423Gene Name
LILRB2
Gene Alias
CD85D, ILT4, LILRA6, LIR-2, LIR2, MIR-10, MIR10
Gene Description
leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
Omim ID
604815Gene Ontology
HyperlinkGene Summary
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Ig-like transcript 4|OTTHUMP00000067358|OTTHUMP00000067463|eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6|immunoglobulin-like transcript 4|leukocyte immunoglobulin-like receptor 2|leukocyte immunoglobulin-like receptor subfa
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com