IL4 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human IL4 recombinant protein with His tag expressed in Escherichia coli.
Sequence
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Host
Escherichia coli
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purification
Ni-NTA chromatography
Purity
> 98% by SDS-PAGE
Endotoxin Level
< 0.1 EU/ug
Activity
Measured by the induction of TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity is approximately > 2.8 x 107 IU/mg.
Quality Control Testing
SDS-PAGE Stained with Coomassie Blue
Recommend Usage
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from PBS, pH 8.0.
Storage Instruction
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freezing and thawing.
-
Applications
Functional Study
The ED50 for this effect is <0.2 ng/mL, measured by the induction of TF-1 cells proliferation.SDS-PAGE
-
Gene Info — IL4
Entrez GeneID
3565Gene Name
IL4
Gene Alias
BCGF-1, BCGF1, BSF1, IL-4, MGC79402
Gene Description
interleukin 4
Omim ID
147780Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
B cell growth factor 1|B_cell stimulatory factor 1|lymphocyte stimulatory factor 1
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com