
Il17a (Rat) Recombinant Protein

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rat Il17a recombinant protein expressed in Escherichia coli.
This product with activity data is belong to bioactive protein.Sequence
MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
Host
Escherichia coli
Theoretical MW (kDa)
30
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts. The expected ED50 for this effect is 0.44-0.66 ng/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
Lyophilized from 10 mM sodium citrate, pH 3.0
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
Result of activity analysis
Serial dilutions of rat Il17a (starting at 2.5 ug/mL) were added to NIH 3T3 cells. After 48 hours, production of mouse IL-6 was measured and the linear portion of the curve was us used to calculate the ED50.
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — Il17a
-
Publication Reference
-
Interleukin-17A Acts to Maintain Neuropathic Pain Through Activation of CaMKII/CREB Signaling in Spinal Neurons.
Yao CY, Weng ZL, Zhang JC, Feng T, Lin Y, Yao S.
Molecular Neurobiology 2016 Aug; 53(6):3914.
Application:Added, Recombinant protein.
-
Interleukin-17A Acts to Maintain Neuropathic Pain Through Activation of CaMKII/CREB Signaling in Spinal Neurons.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com