KIT monoclonal antibody, clone CL1657
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of RT-4 cell lysates with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong positivity in a subset of lymphoid cells.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells (macrophages).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows moderate positivity in neuropil of the molecular layer.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human KIT.
Immunogen
Recombinant protein corresponding to amino acids 50-190 of human KIT.
Sequence
VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of RT-4 cell lysates with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong positivity in a subset of lymphoid cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells (macrophages).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows moderate positivity in neuropil of the molecular layer. -
Gene Info — KIT
Entrez GeneID
3815Protein Accession#
P10721Gene Name
KIT
Gene Alias
C-Kit, CD117, PBT, SCFR
Gene Description
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Gene Ontology
HyperlinkGene Summary
This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
mast/stem cell growth factor receptor|proto-oncogene tyrosine-protein kinase Kit|soluble KIT variant 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com