KIT monoclonal antibody, clone CL1657

Catalog # MAB15538

Size

Price

Stock

Quantity

Size:100 uL
Price: USD $ 428.00
Stock:
order now, ship in 5 days
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

Western Blot analysis of RT-4 cell lysates with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong positivity in a subset of lymphoid cells.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells (macrophages).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows moderate positivity in neuropil of the molecular layer.

  • Specification

    Product Description

    Mouse monoclonal antibody raised against partial recombinant human KIT.

    Immunogen

    Recombinant protein corresponding to amino acids 50-190 of human KIT.

    Sequence

    VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ

    Host

    Mouse

    Reactivity

    Human

    Form

    Liquid

    Purification

    Protein A purification

    Isotype

    IgG1

    Recommend Usage

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
    Western Blot (1:500 - 1:1000)
    The optimal working dilution should be determined by the end user.

    Storage Buffer

    In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).

    Storage Instruction

    Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.

    Note

    This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

  • Applications

    Western Blot (Cell lysate)

    Western Blot analysis of RT-4 cell lysates with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538).

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong positivity in a subset of lymphoid cells.

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells.

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows strong immunoreactivity in a subset of lymphoid cells (macrophages).

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with KIT monoclonal antibody, clone CL1657 (Cat # MAB15538) shows moderate positivity in neuropil of the molecular layer.
  • Gene Info — KIT

    Entrez GeneID

    3815

    Protein Accession#

    P10721

    Gene Name

    KIT

    Gene Alias

    C-Kit, CD117, PBT, SCFR

    Gene Description

    v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog

    Omim ID

    164920 172800 273300 601626 606764

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    mast/stem cell growth factor receptor|proto-oncogene tyrosine-protein kinase Kit|soluble KIT variant 1

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All