![](/upload/media/product/tag/abnova-full-length-tag.png)
SPANXN4 (Human) Recombinant Protein (P01)
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SPANXN4 full-length ORF ( ADR83315.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENNQPTESSTDPIKEKGDLDISAGSPQDGGQN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
10.9
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SPANXN4
Entrez GeneID
441525GeneBank Accession#
HQ258561.1Protein Accession#
ADR83315.1Gene Name
SPANXN4
Gene Alias
SPANX-N4
Gene Description
SPANX family, member N4
Omim ID
300667Gene Ontology
HyperlinkGene Summary
This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members. [provided by RefSeq
Other Designations
-
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com