RICTOR monoclonal antibody (M01), clone 1F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RICTOR.
Immunogen
RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RICTOR monoclonal antibody (M01), clone 1F3 Western Blot analysis of RICTOR expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of RICTOR expression in transfected 293T cell line by RICTOR monoclonal antibody (M01), clone 1F3.
Lane 1: RICTOR transfected lysate(29.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RICTOR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of RICTOR transfected lysate using anti-RICTOR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RICTOR MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RICTOR is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RICTOR
Entrez GeneID
253260GeneBank Accession#
NM_152756Protein Accession#
NP_689969Gene Name
RICTOR
Gene Alias
DKFZp686B11164, KIAA1999, MGC39830, mAVO3
Gene Description
rapamycin-insensitive companion of mTOR
Omim ID
609022Gene Ontology
HyperlinkGene Summary
RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM
Other Designations
TORC2-specific protein AVO3|pianissimo
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
In situ characterization of the mTORC1 during adipogenesis of human adult stem cells on chip.
Wu X, Schneider N, Platen A, Mitra I, Blazek M, Zengerle R, Schule R, Meier M.
PNAS 2016 Jul; 113(29):E4143.
Application:PLA, Human, hASCs.
-
GNAQ and BRAF mutations show differential activation of the mTOR pathway in human transformed cells.
Populo H, Tavares S, Faustino A, Nunes JB, Lopes JM, Soares P.
PeerJ 2013 Jul; 1:e104.
Application:WB-Tr, Human, HEK 293 cells.
-
mTOR pathway overactivation in BRAF mutated papillary thyroid carcinoma.
Faustino A, Couto JP, Pópulo H, Rocha AS, Pardal F, Cameselle-Teijeiro JM, Lopes JM, Sobrinho-Simões M, Soares P.
The Journal of Clinical Endocrinology and Metabolism 2012 Jul; 97(7):E1139.
Application:IHC-P, Human, Human papillary thyroid carcinoma.
-
Nuclear forkhead box O1 controls and integrates key signaling pathways in hepatocytes.
Naimi M, Gautier N, Chaussade C, Valverde AM, Accili D, Van Obberghen E.
Endocrinology 2007 Feb; 148(5):2424.
Application:WB, Rat, Rat hepatocyte.
-
In situ characterization of the mTORC1 during adipogenesis of human adult stem cells on chip.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com