RNF111 monoclonal antibody (M05), clone 1C4
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF111.
Immunogen
RNF111 (NP_060080, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody (M05), clone 1C4.
Lane 1: RNF111 transfected lysate(107.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF111 is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi ( Cat # H00054778-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF111 monoclonal antibody (M05), clone 1C4 (Cat # H00054778-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to RNF111 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RNF111
Entrez GeneID
54778GeneBank Accession#
NM_017610Protein Accession#
NP_060080Gene Name
RNF111
Gene Alias
ARK, DKFZp313E0731, DKFZp686H1966, DKFZp761D081, FLJ38008
Gene Description
ring finger protein 111
Omim ID
605840Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger domain, a motif known to be involved in protein-protein and protein-DNA interactions. The mouse counterpart of this gene (Rnf111/arkadia) has been shown to genetically interact with the transforming growth factor (TGF) beta-like factor Nodal, and act as a modulator of the nodal signaling cascade, which is essential for the induction of mesoderm during embryonic development. [provided by RefSeq
Other Designations
Arkadia
-
Interactome
-
Publication Reference
-
The UAS thioredoxin-like domain of UBXN7 regulates E3 ubiquitin ligase activity of RNF111/Arkadia.
Sadek Amhaz, Batiste Boëda, Mouna Chouchène, Sabrina Colasse, Florent Dingli, Damarys Loew, Julien Henri, Céline Prunier, Laurence Levy.
BMC Biology 2023 Apr; 21(1):73.
Application:WB-Ce, WB-Tr, Human , HKE293, U2OS cells.
-
Quantitative ubiquitylome analysis reveals specificity of RNF111/Arkadia E3 ubiquitin ligase for its degradative substrates SKI and SKIL/SnoN in TGF-β signaling pathway.
Victor Laigle, Florent Dingli, Sadek Amhaz, Tiphaine Perron, Mouna Chouchène, Sabrina Colasse, Isabelle Petit, Patrick Poullet, Damarys Loew, Céline Prunier, Laurence Levy.
Molecular & Cellular proteomics: MCP 2021 Nov; 20:100173.
Application:WB-Ce, WB-Tr, Human, U-2 OS cells.
-
Arkadia (RING Finger Protein 111) Mediates Sumoylation-Dependent Stabilization of Nrf2 Through K48-Linked Ubiquitination.
McIntosh DJ, Walters TS, Arinze IJ, Davis J.
Cellular Physiology and Biochemistry 2018 Mar; 46(1):418.
Application:WB, Human, HepG2 cells.
-
SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.
van Cuijk L, van Belle GJ, Turkyilmaz Y, Poulsen SL, Janssens RC, Theil AF, Sabatella M, Lans H, Mailand N, Houtsmuller AB, Vermeulen W, Marteijn JA.
Nature Communications 2015 Jul; 6:7499.
Application:WB-Ce, Human, HeLa/FLAG-SUMO2 cells.
-
RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.
Poulsen SL, Hansen RK, Wagner SA, van Cuijk L, van Belle GJ, Streicher W, Wikstrom M, Choudhary C, Houtsmuller AB, Marteijn JA, Bekker-Jensen S, Mailand N.
The Journal of Cell Biology 2013 Jun; 201(6):797.
Application:WB-Tr, Human, U2OS cells.
-
Arkadia, a Novel SUMO-Targeted Ubiquitin Ligase Involved in PML Degradation.
Erker Y, Neyret-Kahn H, Seeler JS, Dejean A, Atfi A, Levy L.
Molecular and Cellular Biology 2013 Jun; 33(11):2163.
Application:WB-Tr, Human, HeLa, HEK 293, HT1080-GFP-PML cells.
-
RNF111-Dependent Neddylation Activates DNA Damage-Induced Ubiquitination.
Ma T, Chen Y, Zhang F, Yang CY, Wang S, Yu X.
Molecular Cell 2013 Mar; 49(5):897.
Application:WB, Human, U2OS cells.
-
RB1CC1 positively regulates transforming growth factor-{beta} signaling through the modulation of Arkadia E3 ubiquitin ligase activity.
Koinuma D, Shinozaki M, Nagano Y, Ikushima H, Horiguchi K, Goto K, Chano T, Saitoh M, Imamura T, Miyazono K, Miyazawa K.
The Journal of Biological Chemistry 2011 Sep; 286(37):32502.
Application:WB-Tr, Human, HaCaT, HEK 293T cells.
-
Efficient TGF-beta/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression.
Javelaud D, van Kempen L, Alexaki VI, Le Scolan E, Luo K, Mauviel A.
Molecular Cancer 2011 Jan; 10(1):2.
Application:WB, Human, Melanoma cells.
-
Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells.
Nagano Y, Koinuma D, Miyazawa K, Miyazono K.
Journal of Biochemistry 2010 Apr; 147(4):545.
Application:WB-Tr, Human, OCUM-2MLN.
-
Overexpression of snon/skil, amplified at the 3q26.2 locus, in ovarian cancers: a role in ovarian pathogenesis.
Nanjundan M, Cheng KW, Zhang F, Lahad J, Kuo WL, Schmandt R, Smith-McCune K, Fishman D, Gray JW, Mills GB.
Molecular Oncology 2008 May; 2(2):164.
Application:WB-Ti, Human, Human ovarian cancer.
-
Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.
Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill CS.
Molecular and Cellular Biology 2007 Jun; 27(17):6068.
Application:WB-Tr, Human, HaCaT cells.
-
The UAS thioredoxin-like domain of UBXN7 regulates E3 ubiquitin ligase activity of RNF111/Arkadia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com