GDAP1 polyclonal antibody (A01)
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GDAP1.
Immunogen
GDAP1 (NP_061845, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
Sequence
TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GDAP1 polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of GDAP1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — GDAP1
Entrez GeneID
54332GeneBank Accession#
NM_018972Protein Accession#
NP_061845Gene Name
GDAP1
Gene Alias
-
Gene Description
ganglioside-induced differentiation-associated protein 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Effective therapeutic strategies in a pre-clinical mouse model of Charcot-Marie-tooth disease.
Cristina Nuevo-Tapioles, Fulvio Santacatterina, Brenda Sánchez-Garrido, Cristina Núñez Arenas, Adrián Robledo-Bérgamo, Paula Martínez-Valero, Lara Cantarero, Beatriz Pardo, Janet Hoenicka, Michael P Murphy, Jorgina Satrústegui, Francesc Palau, José M Cuezva.
Human Molecular Genetics 2021 Nov; 30(24):2441.
Application:WB-Tr, Human, SH-SY5Y cells.
-
AMPK activation negatively regulates GDAP1, which influences metabolic processes and circadian gene expression in skeletal muscle.
Lassiter DG, Sjögren RJO, Gabriel BM, Krook A, Zierath JR.
Molecular Metabolism 2018 Oct; 16:12.
Application:WB-Ce, Human, Skeletal muscle cells.
-
CMT-linked loss-of-function mutations in GDAP1 impair store-operated Ca2+ entry-stimulated respiration.
González-Sánchez P, Pla-Martín D, Martínez-Valero P, Rueda CB, Calpena E, Del Arco A, Palau F, Satrústegui J.
Scientific Reports 2017 Feb; 7:42993.
Application:WB, Human, HEK 293T cells.
-
Silencing of the Charcot-Marie-Tooth disease-associated gene GDAP1 induces abnormal mitochondrial distribution and affects Ca2+ homeostasis by reducing store-operated Ca2+ entry.
Pla-Martin D, Rueda CB, Estela A, Sanchez-Piris M, Gonzalez-Sanchez P, Traba J, de la Fuente S, Scorrano L, Renau-Piqueras J, Alvarez J, Satrustegui J, Palau F.
Neurobiology of Disease 2013 Jul; 55:140.
Application:WB-Ti, Mouse, Brain.
-
Charcot-Marie-Tooth-related Gene GDAP1 Complements Cell Cycle Delay at G2/M Phase in Saccharomyces cerevisiae fis1 Gene-defective Cells.
Estela A, Pla-Martin D, Sanchez-Piris M, Sesaki H, Palau F.
The Journal of Biological Chemistry 2011 Oct; 286(42):36777.
Application:WB-Tr, Yeast, Yeast cells.
-
Mitochondrial complex I deficiency in GDAP1-related autosomal dominant Charcot-Marie-Tooth disease (CMT2K).
Cassereau J, Chevrollier A, Gueguen N, Malinge MC, Letournel F, Nicolas G, Richard L, Ferre M, Verny C, Dubas F, Procaccio V, Amati-Bonneau P, Bonneau D, Reynier P.
Neurogenetics 2008 Dec; 10(2):145.
Application:WB, Human, Human skin fibroblasts.
-
Effective therapeutic strategies in a pre-clinical mouse model of Charcot-Marie-tooth disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com