ZAK monoclonal antibody (M03), clone 3G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZAK.
Immunogen
ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG3 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZAK on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ZAK on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ZAK
Entrez GeneID
51776GeneBank Accession#
BC001401Protein Accession#
AAH01401Gene Name
ZAK
Gene Alias
AZK, MLK7, MLT, MLTK, MRK, mlklak
Gene Description
sterile alpha motif and leucine zipper containing kinase AZK
Omim ID
609479Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
MLK-like mitogen-activated protein triple kinase|MLK-related kinase|cervical cancer suppressor gene 4 protein|leucine zipper- and sterile alpha motif-containing kinase|mitogen-activated protein kinase kinase kinase MLT|mixed lineage kinase 7|mixed lineage
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A Requirement for ZAK Kinase Activity in Canonical TGF-β Signaling.
Nyati S, Chator A, Schinske K, Gregg BS, Ross BD, Rehemtulla A.
Translational Oncology 2016 Oct; 9(6):473.
Application:IP-WB, WB-Tr, Human, A549, MDA-231-1833, HEK 293T cells.
-
A-Kinase Anchoring Protein Lbc Coordinates a p38 Activating Signaling Complex Controlling Compensatory Cardiac Hypertrophy.
Perez Lopez I, Cariolato L, Maric D, Gillet L, Abriel H, Diviani D.
Molecular and Cellular Biology 2013 Aug; 33(15):2903.
Application:WB-Ce, WB-Tr, WB-Ti, Rat, Mouse, Neonatal ventricular myocytes, Cardiac.
-
AKAP-LBC anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation.
Cariolato L, Cavin S, Diviani D.
The Journal of Biological Chemistry 2011 Mar; 286(10):7925.
Application:WB, Human, HEK 293 cells.
-
A Requirement for ZAK Kinase Activity in Canonical TGF-β Signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com