![](/upload/media/product/tag/abnova-full-length-tag.png)
CROP (Human) Recombinant Protein (P01)
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CROP full-length ORF ( AAH56409.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.6
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CROP
Entrez GeneID
51747GeneBank Accession#
BC056409.1Protein Accession#
AAH56409.1Gene Name
CROP
Gene Alias
LUC7A, OA48-18
Gene Description
cisplatin resistance-associated overexpressed protein
Omim ID
609434Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
okadaic acid-inducible phosphoprotein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com