PCQAP monoclonal antibody (M02), clone 4A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCQAP.
Immunogen
PCQAP (NP_056973, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MED15 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PCQAP on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MED15
Entrez GeneID
51586GeneBank Accession#
NM_015889Protein Accession#
NP_056973Gene Name
MED15
Gene Alias
ARC105, CAG7A, CTG7A, DKFZp686A2214, DKFZp762B1216, FLJ42282, FLJ42935, PCQAP, TIG-1, TIG1, TNRC7
Gene Description
mediator complex subunit 15
Omim ID
607372Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CTG repeat protein 7a|PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein|PC2-glutamine-rich-associated protein|TPA inducible gene-1|TPA inducible protein|activator-recruited cofactor, 105-kD|positive cofactor 2, glutamine/
-
Interactome
-
Disease
-
Publication Reference
-
MED19 and MED26 are synergistic functional targets of the RE1 silencing transcription factor in epigenetic silencing of neuronal gene expression.
Ding N, Tomomori-Sato C, Sato S, Conaway RC, Conaway JW, Boyer TG.
The Journal of Biological Chemistry 2008 Dec; 284(5):2648.
Application:WB-Tr, Human, HeLa cells.
-
TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
Varelas X, Sakuma R, Samavarchi-Tehrani P, Peerani R, Rao BM, Dembowy J, Yaffe MB, Zandstra PW, Wrana JL.
Nature Cell Biology 2008 Jun; 10(7):837.
Application:ChIP, IF, WB, Human, COS-7, HepG2, Mv1Lu cells.
-
MED19 and MED26 are synergistic functional targets of the RE1 silencing transcription factor in epigenetic silencing of neuronal gene expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com