NOP16 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NOP16 protein.
Immunogen
NOP16 (AAH40106.1, 1 a.a. ~ 178 a.a) full-length human protein.
Sequence
MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in mouse spleen.Western Blot (Tissue lysate)
HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in human liver.Western Blot (Cell lysate)
HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of NOP16 expression in transfected 293T cell line (H00051491-T03) by NOP16 MaxPab polyclonal antibody.
Lane 1: NOP16 transfected lysate(21.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of NOP16 transfected lysate using anti-NOP16 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with NOP16 purified MaxPab mouse polyclonal antibody (B01P) (H00051491-B01P).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NOP16 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NOP16
Entrez GeneID
51491GeneBank Accession#
BC040106Protein Accession#
AAH40106.1Gene Name
NOP16
Gene Alias
HSPC111, HSPC185
Gene Description
NOP16 nucleolar protein homolog (yeast)
Gene Ontology
HyperlinkGene Summary
NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).[supplied by OMIM
Other Designations
HBV pre-S2 trans-regulated protein 3|NOP16 nucleolar protein homolog|nucleolar protein 16 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com