ERO1L polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1. Western Blot analysis of ERO1L expression in PC-12.
Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1 Western Blot analysis of ERO1L expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1. Western Blot analysis of ERO1L expression in Raw 264.7.
Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1. Western Blot analysis of ERO1L expression in NIH/3T3.
Western Blot detection against Immunogen (35.9 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ERO1L.
Immunogen
ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
Sequence
DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.9 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1. Western Blot analysis of ERO1L expression in PC-12.Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1 Western Blot analysis of ERO1L expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1. Western Blot analysis of ERO1L expression in Raw 264.7.Western Blot (Cell lysate)
ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1. Western Blot analysis of ERO1L expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — ERO1L
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification of a domain within PPAR{gamma} regulating expression of a group of genes containing FGF21 that are selectively repressed by SIRT1 in adipocytes.
Wang H, Qiang L, Farmer SR.
Molecular and Cellular Biology 2007 Oct; 28(1):188.
Application：WB, Mouse, 3T3-L1, NIH/3T3 cells.
-
Adiponectin Secretion is Regulated by SIRT1 and the ER oxidoreductase Ero1-L alpha.
Qiang L, Wang H, Farmer SR.
Molecular and Cellular Biology 2007 Apr; 27(13):4698.
Application：WB, Mouse, NIH/3T3, 3T3-L1 cells.
-
Identification of a domain within PPAR{gamma} regulating expression of a group of genes containing FGF21 that are selectively repressed by SIRT1 in adipocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com