![](/upload/media/product/tag/abnova-maxpab-tag.png)
FBXO6 purified MaxPab mouse polyclonal antibody (B01P)
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FBXO6 protein.
Immunogen
FBXO6 (NP_060908.1, 1 a.a. ~ 293 a.a) full-length human protein.
Sequence
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FBXO6 expression in transfected 293T cell line (H00026270-T01) by FBXO6 MaxPab polyclonal antibody.
Lane 1: FBXO6 transfected lysate(32.23 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FBXO6
Entrez GeneID
26270GeneBank Accession#
NM_018438.4Protein Accession#
NP_060908.1Gene Name
FBXO6
Gene Alias
FBG2, FBS2, FBX6, Fbx6b
Gene Description
F-box protein 6
Omim ID
605647Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq
Other Designations
F-box only protein 6|F-box protein FBG2|F-box protein Fbx6|OTTHUMP00000002267
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com