TARDBP polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant TARDBP.
Immunogen
TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.34 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TARDBP polyclonal antibody (A01), Lot # Abnova060510QCS1 Western Blot analysis of TARDBP expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — TARDBP
Entrez GeneID
23435GeneBank Accession#
NM_007375.3Protein Accession#
NP_031401.1Gene Name
TARDBP
Gene Alias
ALS10, TDP-43
Gene Description
TAR DNA binding protein
Omim ID
605078Gene Ontology
HyperlinkGene Summary
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq
Other Designations
OTTHUMP00000002171|TAR DNA-binding protein-43
-
Interactome
-
Disease
-
Publication Reference
-
TDP-43 and Alzheimer's Disease Pathology in the Brain of a Harbor Porpoise Exposed to the Cyanobacterial Toxin BMAA.
Susanna P Garamszegi, Daniel J Brzostowicki, Thomas M Coyne, Regina T Vontell, David A Davis.
Toxins 2024 Jan; 16(1):42.
Application:IHC, Harbor Porpoise, Brain tissue.
-
Persistent mRNA localization defects and cell death in ALS neurons caused by transient cellular stress.
Sebastian Markmiller, Shashank Sathe, Kari L Server, Thai B Nguyen, Amit Fulzele, Neal Cody, Ashkan Javaherian, Sara Broski, Steven Finkbeiner, Eric J Bennett, Eric Lécuyer, Gene W Yeo.
Cell Reports 2021 Sep; 36(10):109685.
Application:IF, Human, Human pluripotent stem cell-derived motor neurons.
-
Context-Dependent and Disease-Specific Diversity in Protein Interactions within Stress Granules.
Sebastian Markmiller, Sahar Soltanieh, Kari L Server, Raymond Mak, Wenhao Jin, Mark Y Fang, En-Ching Luo, Florian Krach, Dejun Yang, Anindya Sen, Amit Fulzele, Jacob M Wozniak, David J Gonzalez, Mark W Kankel, Fen-Biao Gao, Eric J Bennett, Eric Lécuyer, Gene W Yeo.
Cell 2018 Jan; 172(3):590.
Application:IF, Human, Human iPSC-derived motor neurons.
-
Cell stress induces TDP-43 pathological changes associated with ERK1/2 dysfunction: implications in ALS.
Ayala V, Granado-Serrano AB, Cacabelos D, Naudi A, Ilieva EV, Boada J, Caraballo-Miralles V, Llado J, Ferrer I, Pamplona R, Portero-Otin M.
Acta Neuropathologica 2011 Sep; 122(3):259.
Application:IF, WB-Ce, Rat, Spinal cord.
-
Mimicking aspects of frontotemporal lobar degeneration and Lou Gehrig's disease in rats via TDP-43 overexpression.
Tatom JB, Wang DB, Dayton RD, Skalli O, Hutton ML, Dickson DW, Klein RL.
Molecular Therapy : the Journal of the American Society of Gene Therapy 2009 Feb; 17(4):607.
Application:IF, IHC-P, Rat, Rat brain.
-
TDP-43 pathology in familial British dementia.
Schwab C, Arai T, Hasegawa M, Akiyama H, Yu S, McGeer PL.
Acta Neuropathologica 2009 Aug; 118(2):303.
Application:IF, IHC, Human, Human brains.
-
Colocalization of Transactivation-Responsive DNA-Binding Protein 43 and Huntingtin in Inclusions of Huntington Disease.
Schwab C, Arai T, Hasegawa M, Yu S, McGeer PL.
Journal of Neuropathology and Experimental Neurology 2008 Dec; 67(12):1159.
Application:IF, Human, CNS tissue.
-
A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity.
Johnson BS, McCaffery JM, Lindquist S, Gitler AD.
PNAS 2008 Apr; 105(17):6439.
-
TDP-43 and Alzheimer's Disease Pathology in the Brain of a Harbor Porpoise Exposed to the Cyanobacterial Toxin BMAA.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com