KIAA0056 monoclonal antibody (M01), clone 1D5
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KIAA0056.
Immunogen
KIAA0056 (AAH11408.1, 1 a.a. ~ 341 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63); Rat (65)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (63.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KIAA0056 monoclonal antibody (M01), clone 1D5 Western Blot analysis of KIAA0056 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KIAA0056 on formalin-fixed paraffin-embedded human breast cancer tissue.[antibody concentration 2 ug/ml]ELISA
-
Gene Info — NCAPD3
Entrez GeneID
23310GeneBank Accession#
BC011408.1Protein Accession#
AAH11408.1Gene Name
NCAPD3
Gene Alias
CAP-D3, FLJ42888, KIAA0056, MGC104671, hCAP-D3, hHCP-6, hcp-6
Gene Description
non-SMC condensin II complex, subunit D3
Omim ID
609276Gene Ontology
HyperlinkGene Summary
Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPD3 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Knockdown of NCAPD3 inhibits the tumorigenesis of non-small cell lung cancer by regulation of the PI3K/Akt pathway.
Fan Yang, Yunfeng Zheng, Qiong Luo, Suyun Zhang, Sheng Yang, Xiangqi Chen.
BMC Cancer 2024 Apr; 24(1):408.
Application:IHC-P, Human, Lung.
-
Knockdown of NCAPD3 inhibits the tumorigenesis of non-small cell lung cancer by regulation of the PI3K/Akt pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com