SWAP70 monoclonal antibody (M09A), clone 3H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SWAP70.
Immunogen
SWAP70 (NP_055870, 378 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.88 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in human spleen.Western Blot (Cell lysate)
SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in Raw 264.7.Western Blot (Cell lysate)
SWAP70 monoclonal antibody (M09A), clone 3H8. Western Blot analysis of SWAP70 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody (M09A), clone 3H8.
Lane 1: SWAP70 transfected lysate(69 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SWAP70
-
Interactome
-
Publication Reference
-
SWAP-70 contributes to spontaneous transformation of mouse embryo fibroblasts.
Chang YT, Shu CL, Lai JY, Ching-Yu L, Chuu CP, Morishita K, Ichikawa T, Jessberger R, Fukui Y.
Experimental Cell Research 2016 Jul; 345(2):150.
Application:WB, Mouse, MEF1F2 cells.
-
SWAP-70 contributes to spontaneous transformation of mouse embryo fibroblasts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com