DKK1 monoclonal antibody (M11), clone 2A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant DKK1.
Immunogen
DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DKK1 monoclonal antibody (M11), clone 2A5 Western Blot analysis of DKK1 expression in U-2 OS ( Cat # L022V1 ).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of DKK1 transfected lysate using anti-DKK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DKK1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DKK1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — DKK1
Entrez GeneID
22943GeneBank Accession#
BC001539Protein Accession#
AAH01539.1Gene Name
DKK1
Gene Alias
DKK-1, SK
Gene Description
dickkopf homolog 1 (Xenopus laevis)
Omim ID
605189Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq
Other Designations
OTTHUMP00000019617|dickkopf homolog 1|dickkopf related protein-1|dickkopf-1 like
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Molecular subgrouping of medulloblastoma in pediatric population using the NanoString assay and comparison with immunohistochemistry methods.
Joo Whan Kim, Sung-Hye Park, Seung Ah Choi, Seung-Ki Kim, Eun Jung Koh, Jae-Kyung Won, Sun Mo Nam, Ji Hoon Phi.
BMC Cancer 2022 Nov; 22(1):1221.
-
Dickkopf-1 Promotes Angiogenesis and is a Biomarker for Hepatic Stem Cell-like Hepatocellular Carcinoma.
Tsuyoshi Suda, Taro Yamashita, Hajime Sunagozaka, Hikari Okada, Kouki Nio, Yoshio Sakai,Tatsuya Yamashita, Eishiro Mizukoshi, Masao Honda and Shuichi Kaneko.
International Journal of Molecular Sciences 2022 Mar; 23(5):2801.
Application:WB-Ce, Human, Huh7 cells.
-
Identification of CD24 as a marker of Patched1 deleted medulloblastoma-initiating neural progenitor cells.
Robson JP, Remke M, Kool M, Julian E, Korshunov A, Pfister SM, Osborne GW, Taylor MD, Wainwright B, Reynolds BA.
PLoS One 2019 Jan; 14(1):e0210665.
Application:IHC, Tissue Microarray, Human, Human tissues.
-
RNA interference-mediated targeting of DKK1 gene expression in Ishikawa endometrial carcinoma cells causes increased tumor cell invasion and migration.
Yi N, Liao QP, Li ZH, Xie BJ, Hu YH, Yi W, Liu M.
Oncology Letters 2013 Sep; 6(3):756.
Application:WB-Tr, Human, Ishikawa endometrial carcinoma cells.
-
Genetic grouping of medulloblastomas by representative markers in pathologic diagnosis.
Min HS, Lee JY, Kim SK, Park SH.
Translational Oncology 2013 Jun; 6(3):265.
Application:IHC, Human, Medulloblastoma.
-
Molecular subgroups of medulloblastoma: the current consensus.
Taylor MD, Northcott PA, Korshunov A, Remke M, Cho YJ, Clifford SC, Eberhart CG, Parsons DW, Rutkowski S, Gajjar A, Ellison DW, Lichter P, Gilbertson RJ, Pomeroy SL, Kool M, Pfister SM.
Acta Neuropathologica 2012 Apr; 123(4):465.
Application:IHC, Human, Human medulloblastoma tissues.
-
Prokineticin 1 induces Dickkopf 1 expression and regulates cell proliferation and decidualization in the human endometrium.
Macdonald LJ, Sales KJ, Grant V, Brown P, Jabbour HN, Catalano RD.
Mol Hum Reprod 2011 May; 17:626.
Application:IHC-P, Human, Endometrial tissue.
-
Carbonic anhydrase IX (CA9) modulates tumor-associated cell migration and invasion.
Shin HJ, Rho SB, Jung DC, Han IO, Oh ES, Kim JY.
Journal of Cell Science 2011 Apr; 124(Pt 7):1077.
Application:IP, WB-Tr, Yeast, Yeast cells.
-
Bone and bone marrow pro-osteoclastogenic cytokines are up-regulated in osteoporosis fragility fractures.
D'Amelio P, Roato I, D'Amico L, Veneziano L, Suman E, Sassi F, Bisignano G, Ferracini R, Gargiulo G, Castoldi F, Pescarmona GP, Isaia GC.
Osteoporosis International 2011 Nov; 22(11):2869.
Application:IHC-P, WB-Ti, Human, Bone, Bone marrow.
-
Molecular subgrouping of medulloblastoma in pediatric population using the NanoString assay and comparison with immunohistochemistry methods.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com