POMZP3 monoclonal antibody (M02), clone 2E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant POMZP3.
Immunogen
POMZP3 (NP_694537, 64 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNM*
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POMZP3 monoclonal antibody (M02), clone 2E7 Western Blot analysis of POMZP3 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
POMZP3 monoclonal antibody (M02), clone 2E7. Western Blot analysis of POMZP3 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to POMZP3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POMZP3 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — POMZP3
Entrez GeneID
22932GeneBank Accession#
NM_152992Protein Accession#
NP_694537Gene Name
POMZP3
Gene Alias
MGC8359, POM-ZP3, POM121
Gene Description
POM (POM121 homolog, rat) and ZP3 fusion
Omim ID
600587Gene Ontology
HyperlinkGene Summary
This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3' exons from the ZP3 gene. The 5' end of this gene is similar to the 5` coding region of the POM121 gene which encodes an integral nuclear pore membrane protein. However, the protein encoded by this gene lacks the nuclear pore localization motif. The 3' end of this gene is similar to the last 4 exons of the zona pellucida glycoprotein 3 (ZP3) gene and the encoded protein retains one zona pellucida domain. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq
Other Designations
POM (POM121 rat homolog) and ZP3 fusion|POM-ZP3 fusion protein|POM121/ZP3 fusion protein|POMZP3 fusion protein
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com