ADAMTS13 monoclonal antibody (M06), clone 4F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADAMTS13.
Immunogen
ADAMTS13 (NP_620594, 1328 a.a. ~ 1427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADAMTS13 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ADAMTS13
Entrez GeneID
11093GeneBank Accession#
NM_139025Protein Accession#
NP_620594Gene Name
ADAMTS13
Gene Alias
C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900, TTP, VWFCP, vWF-CP
Gene Description
ADAM metallopeptidase with thrombospondin type 1 motif, 13
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000022496|OTTHUMP00000022497|OTTHUMP00000022498|a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13|vWF-cleaving protease|von Willebrand factor-cleaving protease
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com