USF2 monoclonal antibody (M01), clone 5E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant USF2.
Immunogen
USF2 (NP_003358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
USF2 monoclonal antibody (M01), clone 5E9. Western Blot analysis of USF2 expression in HeLa.Western Blot (Cell lysate)
USF2 monoclonal antibody (M01), clone 5E9. Western Blot analysis of USF2 expression in different cell lines.Western Blot (Cell lysate)
USF2 monoclonal antibody (M01), clone 5E9. Western Blot analysis of USF2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
USF2 monoclonal antibody (M01), clone 5E9. Western Blot analysis of USF2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of USF2 expression in transfected 293T cell line by USF2 monoclonal antibody (M01), clone 5E9.
Lane 1: USF2 transfected lysate(37 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USF2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USF2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — USF2
Entrez GeneID
7392GeneBank Accession#
NM_003367Protein Accession#
NP_003358Gene Name
USF2
Gene Alias
FIP, bHLHb12
Gene Description
upstream transcription factor 2, c-fos interacting
Omim ID
600390Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
c-fos interacting protein|upstream stimulatory factor 2
-
Interactomes
-
Diseases
-
Publication Reference
-
Direct and indirect regulation of β-glucocerebrosidase by the transcription factors USF2 and ONECUT2.
Kathi Ging, Lukas Frick, Johannes Schlachetzki, Andrea Armani, Yanping Zhu, Pierre-André Gilormini, Ashutosh Dhingra, Desirée Böck, Ana Marques, Matthew Deen, Xi Chen, Tetiana Serdiuk, Chiara Trevisan, Stefano Sellitto, Claudio Pisano, Christopher K Glass, Peter Heutink, Jiang-An Yin, David J Vocadlo, Adriano Aguzzi.
NPJ Parkinson's Disease 2024 Oct; 10(1):192.
Application:WB, Human, LN-229L444P cells.
-
Direct and indirect regulation of β-glucocerebrosidase by the transcription factors USF2 and ONECUT2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com